PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre06.g266850.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family GATA
Protein Properties Length: 1459aa    MW: 143900 Da    PI: 6.7214
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre06.g266850.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA42.96.6e-142456135
                GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                        C+nCgtt TplWR  ++g ++LCnaCG+y + +g+
  Cre06.g266850.t1.1 24 CHNCGTTRTPLWR--KEGGSHLCNACGIYLKARGT 56
                        *************..677777**********9987 PP

2GATA43.25.4e-14781814134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         CsnCgtt+TplWR++ +   t CnaCG+y + +g
  Cre06.g266850.t1.1 781 CSNCGTTQTPLWRKDRETGVTMCNACGIYKQTHG 814
                         ****************99999********98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.50.101.4E-171867IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011419.4151872IPR000679Zinc finger, GATA-type
SMARTSM004014.7E-141867IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.62E-122069No hitNo description
CDDcd002029.54E-172362No hitNo description
PfamPF003206.4E-112456IPR000679Zinc finger, GATA-type
PROSITE profilePS5011418.94775835IPR000679Zinc finger, GATA-type
SMARTSM004019.3E-11775826IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.8E-12776821No hitNo description
Gene3DG3DSA:3.30.50.101.9E-16780819IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440781806IPR000679Zinc finger, GATA-type
PfamPF003203.6E-12781814IPR000679Zinc finger, GATA-type
CDDcd002024.34E-16781819No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1459 aa     Download sequence    Send to blast
MDDDVQPAVS RPAHGRSSKQ EKVCHNCGTT RTPLWRKEGG SHLCNACGIY LKARGTHRPV  60
ELIRAQMILS ARRGTGPDGG TGNDGGGGGS RARAVANQIT RKSARKRTLR PGEGADDDDN  120
YVSAKTARVA THARRPHLPP HASDAASTLM RNRLLAYSLA MGYTGNGGGA TVGGGAGGHG  180
PMLMPLHGTA LAADGGLHGG AGHRGFGGGG AGGNGGLARL HALHAAQQRF NAGGGMFGGG  240
GGFAGALAEE HNAALARYYG GGDGGEVGDG GDGSQDDEFM AYNGEGLQRG LYAGDGLPGG  300
YGSGQTEEDE EEEEEEEDAL IDGSVGGVDG MNPELSTCPE LKADDDACAV ASFLLMMRAG  360
PSRGRKAAAN AAAPQQQLVP LQLVPQREDA AVHQSLEAAV AAAQRAAGGM QLGGEHEDGS  420
LPTDLAPGTP AAAGAAEVTA VVLEGNAAPA EAAAGDAAVK VQEEQTLAKP VSESEPGQPT  480
SSTGTARPQP LTVQPTTSSQ DGPDCVRLPQ LVLAAAGSES PLVQSGADGA AEELAAAAMA  540
AAAARSDVTK ASPTGSDACD ENVLGSLAPA VGAAAAAAAA AGDSDEAEER PADELLATMA  600
PVGYRARNLD PASLQVRGEP TREHVVAPLV IPPPRPQHGA AGSRDRASMQ VQVVAAADFS  660
AASAGLPLGV GAAALLGTDA LRGLAGRGLS PQLALAALQQ QHALENQHLQ QQLQLAAAAA  720
AGLGQGQQLG AGAQAAGSHV PKVNPNSVSA TASRHAATIA AGGCPPPPPR PPRNHRGPLL  780
CSNCGTTQTP LWRKDRETGV TMCNACGIYK QTHGFDRPIG RNQAGGGAAA AVTKRGSGGG  840
ARGSVPPAAG KPDLATAAAV AAAAAMASER AAGVPICSWT AVGTLNPPSA SGSHLGGGDH  900
SGWAGSAGGN EALGGGKGKG RGSRAASPSP AAAGVLGSGG CSVERSASPR SGSVPNSNGR  960
GAGEDGDDQT ATTAGAAGAA AAGAKRPHDG TEQQQLQLLM LLEKERARGR RMDGTFSSWV  1020
MQTGPALASG GARRAVAPAA AAPRSPGGAD AGSNGKEAAA SPTTLDGIPV IKPINAARQG  1080
QQPPQAAAGS GHQSAAAAAS RSPASPSASP SPSPQQPQQP SGAAAGTAAA TTADGSDAGR  1140
GAQAAQGVRI HARPLQVQGQ QMSALRAAGV TLGPRMAQPR ADAAEVEADE AGAGPADAAR  1200
MDGAEADAER VKPKLDAAAA AAVPMKEETM QDAGAEKPRP GSALQSRELQ VQQQQRSAMP  1260
LQRLERDGPS SGAGGVVLRE LLAGGFGGGG GGSPLAAAAL QQQHELQRME LRAALAAADA  1320
GDMSRVALML HQQQQQRSQA ALALMQQQDQ FALALAARQA GYLGAFGDGP AMGRGGGGLG  1380
GVGGGRGMSL DTAALLMASA AGNGGGGGGL RQSLGAGGGG LGGLSAAQQQ QLLALHLRDT  1440
AAAGGLMQGG GRRGLDRL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre06.g266850.t1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4830810